PDB entry 2cwk

View 2cwk on RCSB PDB site
Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii
Class: transferase
Keywords: transferase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-21, released 2005-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside-diphosphate kinase
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cwka1
  • Chain 'B':
    Compound: nucleoside-diphosphate kinase
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cwkb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwkA (A:)
    mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehre
    kpffkalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaic
    nvihasdskesaereislffkpeelfeypraadwfykkgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwkA (A:)
    etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
    alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
    sdskesaereislffkpeelfeypraadwfykk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwkB (B:)
    mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehre
    kpffkalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaic
    nvihasdskesaereislffkpeelfeypraadwfykkgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwkB (B:)
    etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
    alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
    sdskesaereislffkpeelfeypraadwfyk