PDB entry 2cwk

View 2cwk on RCSB PDB site
Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii
Class: transferase
Keywords: transferase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-21, released 2005-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.209
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside-diphosphate kinase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cwka1
  • Chain 'B':
    Compound: nucleoside-diphosphate kinase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cwkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwkA (A:)
    mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehre
    kpffkalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaic
    nvihasdskesaereislffkpeelfeypraadwfykkgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwkA (A:)
    etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
    alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
    sdskesaereislffkpeelfeypraadwfykk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwkB (B:)
    mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehre
    kpffkalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaic
    nvihasdskesaereislffkpeelfeypraadwfykkgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwkB (B:)
    etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
    alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
    sdskesaereislffkpeelfeypraadwfyk