PDB entry 2cwj

View 2cwj on RCSB PDB site
Description: crystal structure of APE1501, a putative endonuclease from Aeropyrum pernix
Class: hydrolase
Keywords: HYDROLASE, endoribonucrease, Aeropyrum pernix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-21, released 2005-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: putative endonuclease
  Species: Aeropyrum pernix [TaxId:272557]
  Database cross-references and differences (RAF-indexed):
  • GB BAA80500
  Domains in SCOPe 2.08: d2cwja1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2cwjA (A:)
  metapkpvgpysqavesgcfmfvsgqipinpetgaleeggfkesakraldnlkaivegag
  ysmddivkvtvyitdisrfsefnevyreyfnrpyparavvgvaalplgapleveavlytc
  rrk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2cwjA (A:)
  apkpvgpysqavesgcfmfvsgqipinpetgaleeggfkesakraldnlkaivegagysm
  ddivkvtvyitdisrfsefnevyreyfnrpyparavvgvaalplgapleveavlyt