PDB entry 2cwi

View 2cwi on RCSB PDB site
Description: X-ray crystal structure analysis of recombinant wild-type canine milk lysozyme (apo-type)
Class: hydrolase
Keywords: LUSOZYME C, MILK ISOZYME, CALCIUM BINDING LYSOZYME, 1, 4-BETA-N-ACETYLMURAMIDASE C, Bacteriolytic enzyme, Glycosidase, Hydrolase
Deposited on 2005-06-20, released 2006-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C, milk isozyme
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cwia_
  • Chain 'B':
    Compound: Lysozyme C, milk isozyme
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cwib_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cwiA (A:)
    kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln
    skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl
    skylascnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cwiB (B:)
    kifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifqln
    skwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkdl
    skylascnl