PDB entry 2cwa

View 2cwa on RCSB PDB site
Description: Crystal Structure Of The Single-stranded DNA Binding Protein From Thermus Thermophilus HB8
Class: DNA binding protein
Keywords: ssb, single-stranded DNA binding protein, Thermus Thermophilus HB8, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-06-17, released 2005-12-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.242
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP9
      • modified residue (19)
      • modified residue (64)
      • modified residue (133)
    Domains in SCOPe 2.04: d2cwaa_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwaA (A:)
    marglnrvfligalatrpdmrytpaglaildltlagqdlllsdnggerevswyhrvrllg
    rqaemwgdlldqgqlvfvegrleyrqweregerrselqiradfldplddrgkeraedsrg
    qprlraalnqvflmgnltrdpelrytpqgtavarlglavnerrqgaeerthfvevqawrd
    laewaaelrkgdglfvigrlvndswtsssgerrfqtrvealrlerptrgpaqaggsrsre
    vqtggvdidegledfppeeelpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwaA (A:)
    rglnrvfligalatrpdmrytpaglaildltlagqdllrevswyhrvrllgrqaemwgdl
    ldqgqlvfvegrleyrqselqiradfldplddrgkeraedsrgqprlraalnqvflmgnl
    trdpelrytpqgtavarlglavnererthfvevqawrdlaewaaelrkgdglfvigrlvn
    dswtsssgerrfqtrvealrlerptr