PDB entry 2cw9

View 2cw9 on RCSB PDB site
Description: Crystal structure of human Tim44 C-terminal domain
Class: protein transport
Keywords: Structure Genomics, TIM, Structural Genomics, NPPFSA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, PROTEIN TRANSPORT
Deposited on 2005-06-17, released 2005-12-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translocase of inner mitochondrial membrane
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cw9a1
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cw9A (A:)
    gssgssgdesdnafirasraltdkvtdllgglfsktemsevlteilrvdpafdkdrflkq
    cendiipnvleamisgeldilkdwcyeatysqlahpiqqakalglqfhsrildidnvdla
    mgkmveqgpvliitfqaqlvmvvrnpkgevvegdpdkvlrmlyvwalcrdqdelnpyaaw
    rlldisassteqil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cw9A (A:)
    nafirasraltdkvtdllgglfsktemsevlteilrvdpafdkdrflkqcendiipnvle
    amisgeldilkdwcyeatysqlahpiqqakalglqfhsrildidnvdlamgkmveqgpvl
    iitfqaqlvmvvrnpkgevvegdpdkvlrmlyvwalcrdqdelnpyaawrlldisasste
    qi