PDB entry 2cw4

View 2cw4 on RCSB PDB site
Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-16, released 2005-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.145
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation inhibitor
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SM06 (0-123)
      • modified residue (0)
      • modified residue (52)
      • modified residue (79)
    Domains in SCOPe 2.08: d2cw4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cw4A (A:)
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae