PDB entry 2cw1

View 2cw1 on RCSB PDB site
Description: Solution structure of the de novo-designed lambda Cro fold protein
Class: de novo protein
Keywords: lambda cro fold
Deposited on 2005-06-15, released 2005-12-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SN4m
    Species: synthetic, synthetic
    Domains in SCOP 1.73: d2cw1a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cw1A (A:)
    mrkkldlkkfvedknqeyaaralglsqklieevlkrglpvyvetnkdgnikvyitqdgit
    qpfpp