PDB entry 2cw1

View 2cw1 on RCSB PDB site
Description: Solution structure of the de novo-designed lambda Cro fold protein
Class: de novo protein
Keywords: lambda cro fold, de novo protein
Deposited on 2005-06-15, released 2005-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SN4m
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2CW1 (0-64)
    Domains in SCOPe 2.08: d2cw1a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cw1A (A:)
    mrkkldlkkfvedknqeyaaralglsqklieevlkrglpvyvetnkdgnikvyitqdgit
    qpfpp