PDB entry 2cvz

View 2cvz on RCSB PDB site
Description: Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8
Class: oxidoreductase
Keywords: hydroxyisobutyrate, valine catabolism, NADP+, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-14, released 2005-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLQ6 (Start-288)
      • modified residue (11)
      • modified residue (15)
      • modified residue (130)
      • modified residue (239)
      • modified residue (261)
    Domains in SCOP 1.73: d2cvza1, d2cvza2
  • Chain 'B':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLQ6 (Start-288)
      • modified residue (11)
      • modified residue (15)
      • modified residue (130)
      • modified residue (239)
      • modified residue (261)
    Domains in SCOP 1.73: d2cvzb1, d2cvzb2
  • Chain 'C':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLQ6 (0-288)
      • modified residue (0)
      • modified residue (11)
      • modified residue (15)
      • modified residue (130)
      • modified residue (239)
      • modified residue (261)
    Domains in SCOP 1.73: d2cvzc1, d2cvzc2
  • Chain 'D':
    Compound: 3-hydroxyisobutyrate dehydrogenase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLQ6 (Start-288)
      • modified residue (11)
      • modified residue (15)
      • modified residue (130)
      • modified residue (239)
      • modified residue (261)
    Domains in SCOP 1.73: d2cvzd1, d2cvzd2
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cvzA (A:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvzA (A:)
    ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
    clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
    gaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaage
    gllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiamg
    vldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cvzB (B:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvzB (B:)
    ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
    clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
    gaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaage
    gllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiamg
    vldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cvzC (C:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cvzD (D:)
    mekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvif
    tclpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggt
    sgaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaag
    egllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiam
    gvldgekapspllrlarevyemakrelgpdadhvealrllerwggveir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvzD (D:)
    ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
    clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
    gaeagtltvmlggpeeavervrpflayakkvvhvgpvgaghavkainnallavnlwaage
    gllalvkqgvsaekalevinassgrsnatenlipqrvltrafpktfalgllvkdlgiamg
    vldgekapspllrlarevyemakrelgpdadhvealrllerwggveir