PDB entry 2cvr

View 2cvr on RCSB PDB site
Description: NMR solution structure of sso7d mutant, K12L, 12 conformers
Class: DNA binding protein
Keywords: DNA-binding protein, thermostable protein, NMR, Sulfolobus solfataricus, single point mutation
Deposited on 2005-06-13, released 2006-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-04.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein 7a
  Species: Sulfolobus solfataricus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61991 (0-61)
    • engineered (11)
  Domains in SCOP 1.75: d2cvra1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cvrA (A:)
  atvkfkykgeelqvdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
  qk