PDB entry 2cve

View 2cve on RCSB PDB site
Description: Crystal structure of a conserved hypothetical protein TT1547 from thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: COG1739, UPF0029, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-06-02, released 2005-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA1053
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cvea1, d2cvea2
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cveA (A:)
    msltladkvvyeeeiqksrfiakaapvaseeealaflaenrepeathnghaykigllyrf
    sddgepsgtagrpilhaieaqgldrvavlvvryfggvklgagglvrayggvaaealrrap
    kvplvervglaflvpfaevgrvyallearalkaeetytpegvrfalllpkperegflral
    ldatrgqvale
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cveA (A:)
    sltladkvvyeeeiqksrfiakaapvaseeealaflaenrepeathnghaykigllyrfs
    ddgepsgtagrpilhaieaqgldrvavlvvryfggvklgagglvrayggvaaealrrapk
    vplvervglaflvpfaevgrvyallearalkaeetytpegvrfalllpkperegflrall
    datrgqvale