PDB entry 2cvc

View 2cvc on RCSB PDB site
Description: Crystal structure of High-Molecular Weight Cytochrome c from Desulfovibrio vulgaris (Hildenborough)
Class: electron transport
Keywords: electron transport
Deposited on 2005-06-02, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High-molecular-weight cytochrome c precursor
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cvca_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cvcA (A:)
    mrngrtllrwagvlaataiigvggfwsqgttkalpegpgekradlieigamerfgkldlp
    kvafrhdqhttavtgmgkdcaachkskdgkmslkfmrlddnsaaelkeiyhancigchtd
    lakagkktgpqdgecrschnpkpsaasswkeigfdkslhyrhvaskaikpvgdpqkncga
    chhvydeaskklvwgknkedscrachgekpvdkrpaldtaahtacischmdvaktkaetg
    pvncagchapeaqakfkvvrevprldrgqpdaalilpvpgkdapremkgtmkpvafdhka
    heakandcrtchhvridtctachtvngtadskfvqlekamhqpdsmrscvgchntrvqqp
    tcagchgfikptksdaqcgvchvaapgfdakqveagallnlkaeqrsqvaasmlsarpqp
    kgtfdlndipekvvigsiakeyqpsefphrkivktliagigedklaatfhiekgtlcqgc
    hhnspasltppkcaschgkpfdadrgdrpglkaayhqqcmgchdrmkiekpantacvdch
    kerak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvcA (A:)
    ekradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmrld
    dnsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdkslh
    yrhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpaldt
    aahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilpvp
    gkdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqleka
    mhqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveagall
    nlkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktliag
    igedklaatfhiekgtlcqgchhnspasltppkcaschgkpdrpglkaayhqqcmgchdr
    mkiekpantacvdchkerak