PDB entry 2cv6

View 2cv6 on RCSB PDB site
Description: Crystal Structure of 8Salpha Globulin, the Major Seed Storage Protein of Mungbean
Class: plant protein
Keywords: cupin, PLANT PROTEIN
Deposited on 2005-05-31, released 2006-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seed storage protein
    Species: Vigna radiata [TaxId:157791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv6a1, d2cv6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cv6A (A:)
    midgaevsvsrgknnpfyfnsdrwfhtlfrnqfghlrvlqrfdqrskqmqnlenyrvvef
    nskpntlllphhadadfllvvlngravltlvnpdgrdsnileqghaqkipagttfflvnp
    ddeenlriiklavpvnnphrfqdfflssteaqqsylqgfsknileasfdsdikeisrvlf
    geegqqqqqgqesqqegvivelkreqireltkhakssskkslssedqpfnlrnqkpiysn
    klgrwfeitpeknpqlrdldmfirsvdmkegslllphynskaivilvinegkanielvgq
    reqqkqqeeqeeswevqryraelseddvfiipatypvainatsnlnffafginaennqrn
    flagekdnviseiptevldvtfpasgekvqklikkqsesqfvdaqpeqqereearkggkg
    pfvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv6A (A:)
    svsrgknnpfyfnsdrwfhtlfrnqfghlrvlqrfdqrskqmqnlenyrvvefnskpntl
    llphhadadfllvvlngravltlvnpdgrdsnileqghaqkipagttfflvnpddeenlr
    iiklavpvnnphrfqdfflssteaqqsylqgfsknileasfdsdikeisrvlfgsqqegv
    ivelkreqireltkhadqpfnlrnqkpiysnklgrwfeitpeknpqlrdldmfirsvdmk
    egslllphynskaivilvinegkanielvgqreeswevqryraelseddvfiipatypva
    inatsnlnffafginaennqrnflagekdnviseiptevldvtfpasgekvqklikkqse
    sqfvda