PDB entry 2cv5

View 2cv5 on RCSB PDB site
Description: Crystal structure of human nucleosome core particle
Class: Structural Protein/DNA
Keywords: human nucleosome structure, x-ray crystallography, supercoiled DNA path, metal binding site, Structural Protein/DNA COMPLEX
Deposited on 2005-05-31, released 2005-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5a_
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5b_
  • Chain 'C':
    Compound: Histone H2A.a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5c1
  • Chain 'D':
    Compound: Histone H2B K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5d1
  • Chain 'E':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5e_
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5f_
  • Chain 'G':
    Compound: Histone H2A.a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5g_
  • Chain 'H':
    Compound: Histone H2B K
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv5h_
  • Chain 'I':
    Compound: DNA (146-mer)
  • Chain 'J':
    Compound: DNA (146-mer)
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cv5A (A:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5A (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
    aylvglfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cv5B (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5B (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cv5C (C:)
    msgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpkk
    teshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5C (C:)
    rakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaa
    rdnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cv5D (D:)
    mpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysvyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5D (D:)
    krsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrsti
    tsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cv5E (E:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5E (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
    eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cv5F (F:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5F (F:)
    hrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehak
    rktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2cv5G (G:)
    msgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleylt
    aeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpkk
    teshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5G (G:)
    ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2cv5H (H:)
    mpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysvyvykvlkqvhpdtgisskam
    gimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavt
    kytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cv5H (H:)
    rsrkesysvyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.