PDB entry 2cv3

View 2cv3 on RCSB PDB site
Description: Crystal structure of porcine pancreatic elastase complexed with a macroclyclic peptide inhibitor
Class: Hydrolase/Hydrolase inhibitor
Keywords: Protein-inhibitor interaction, macrocyclic peptide, Hydrolase-Hydrolase inhibitor complex
Deposited on 2005-05-31, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase 1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cv3a_
  • Chain 'B':
    Compound: Inhibitor FR901451
    Species: Flexibacter sp. [TaxId:1005]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CV3 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cv3A (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'B':
    No sequence available.