PDB entry 2cuz

View 2cuz on RCSB PDB site
Description: Glutamyl-tRNA synthetase from Thermus thermophilus in complex with L-glutamate
Class: ligase
Keywords: LIGASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-31, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cuza1, d2cuza2
  • Heterogens: GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cuzA (A:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala