PDB entry 2cur

View 2cur on RCSB PDB site
Description: Solution structure of Skeletal muscle LIM-protein 1
Class: metal binding protein
Keywords: LIM, Four and a half LIM domains protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-27, released 2005-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Skeletal muscle LIM-protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: FHL1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13642 (7-62)
    • cloning artifact (0-6)
    • cloning artifact (63-68)
  Domains in SCOPe 2.08: d2cura1, d2cura2, d2cura3, d2cura4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2curA (A:)
  gssgssgcvkcnkaitsggityqdqpwhadcfvcvtcskklagqrftavedqyycvdcyk
  nfvsgpssg