PDB entry 2cuq

View 2cuq on RCSB PDB site
Description: Solution Structure of Second Lim Domain from Human Skeletal Muscle Lim-Protein 2
Class: structural genomics, unknown function
Keywords: Four and a half LIM domains 3, LIM domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-05-27, released 2005-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Four and a half LIM domains 3
  Species: Homo sapiens [TaxId:9606]
  Gene: FHL3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13643 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOPe 2.08: d2cuqa1, d2cuqa2, d2cuqa3, d2cuqa4
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cuqA (A:)
  gssgssgpcyenkfaprcarcsktltqggvtyrdqpwhreclvctgcqtplagqqftsrd
  edpycvacfgelfasgpssg