PDB entry 2cup

View 2cup on RCSB PDB site
Description: Solution structure of the Skeletal muscle LIM-protein 1
Class: metal binding protein
Keywords: Four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-27, released 2005-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Skeletal muscle LIM-protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FHL 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13642 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.08: d2cupa1, d2cupa2, d2cupa3, d2cupa4, d2cupa5
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cupA (A:)
    gssgssgcvecrkpigadskevhyknrfwhdtcfrcakclhplanetfvakdnkilcnkc
    ttredspkckgcfkaivagdqnveykgtvwhkdcfsgpssg