PDB entry 2cum

View 2cum on RCSB PDB site
Description: The solution structure of the 33rd fibronectin type III domain of human Tenascin-X
Class: cell adhesion
Keywords: Hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tenascin-X
    Species: Homo sapiens [TaxId:9606]
    Gene: TNXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22105 (7-98)
      • cloning artifact (0-6)
      • cloning artifact (99-104)
    Domains in SCOPe 2.07: d2cuma1, d2cuma2, d2cuma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cumA (A:)
gssgssgleaprdleakevtprtalltwteppvrpagyllsfhtpggqtqeillpggits
hqllglfpstsynarlqamwgqsllppvstsfttgglrisgpssg