PDB entry 2cul

View 2cul on RCSB PDB site
Description: Crystal structure of the GidA-related protein from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: Rossmann fold, protein-FAD complex, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2005-05-26, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.18
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-inhibited division protein A-related protein, probable oxidoreductase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • GB YP_145163
    Domains in SCOP 1.73: d2cula1
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2culA (A:)
    maayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgslleray
    dpkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvla
    vgsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevpetpstpgyrvry
    lafhpeeweektfrlkrleglyavglcvregdyarmseegkrlaehllhelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2culA (A:)
    aayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgsllerayd
    pkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlav
    gsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevppgyrvrylafhpe
    eweektfrlkrleglyavglcvregdyarmseegkrlaehllhel