PDB entry 2cul

View 2cul on RCSB PDB site
Description: Crystal structure of the GidA-related protein from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: Rossmann fold, protein-FAD complex, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, oxidoreductase
Deposited on 2005-05-26, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.18
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-inhibited division protein A-related protein, probable oxidoreductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB Q5SH33_THET8
    Domains in SCOPe 2.07: d2cula1
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2culA (A:)
    maayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgslleray
    dpkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvla
    vgsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevpetpstpgyrvry
    lafhpeeweektfrlkrleglyavglcvregdyarmseegkrlaehllhelg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2culA (A:)
    aayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgsllerayd
    pkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlav
    gsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevppgyrvrylafhpe
    eweektfrlkrleglyavglcvregdyarmseegkrlaehllhel