PDB entry 2cuj

View 2cuj on RCSB PDB site
Description: Solution structure of SWIRM domain of mouse transcriptional adaptor 2-like
Class: transcription
Keywords: Transcriptional regulation, Nuclear protein, ADA2, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional adaptor 2-like
    Species: Mus musculus [TaxId:10090]
    Gene: Tada2l
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BNK0 (7-107)
      • cloning artifact (0-6)
    Domains in SCOPe 2.07: d2cuja1, d2cuja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cujA (A:)
    gssgssgidsglspsvlmasnsgrrsapplnltglpgteklnekekelcqvvrlvpgayl
    eyksallnechkqgglrlaqaralikidvnktrkiydfliregyitka