PDB entry 2cui

View 2cui on RCSB PDB site
Description: Solution structure of the 31st fibronectin type III domain of the human tenascin X
Class: cell adhesion
Keywords: fibronectin type III domain, tenascin X precursor, extracellular matirx, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tenascin-X
    Species: Homo sapiens [TaxId:9606]
    Gene: TNXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22105 (7-105)
      • cloning artifact (0-6)
      • cloning artifact (106-111)
    Domains in SCOPe 2.08: d2cuia1, d2cuia2, d2cuia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cuiA (A:)
    gssgssgsrprlsqlsvtdvttsslrlnweappgafdsfllrfgvpspstlephprpllq
    relmvpgtrhsavlrdlrsgtlysltlyglrgphkadsiqgtartlsgpssg