PDB entry 2cuf

View 2cuf on RCSB PDB site
Description: Solution structure of the homeobox domain of the human hypothetical protein FLJ21616
Class: DNA binding protein
Keywords: homeobox domain, FLJ21616, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FLJ21616 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FLJ21616
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H701 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.06: d2cufa1, d2cufa2, d2cufa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cufA (A:)
    gssgssgrgsrftwrkeclavmesyfnenqypdeakreeianacnaviqkpgkklsdler
    vtslkvynwfanrrkeikrraniaailessgpssg