PDB entry 2cue

View 2cue on RCSB PDB site
Description: Solution structure of the homeobox domain of the human paired box protein Pax-6
Class: transcription
Keywords: homeobox domain, paired box protein, Pax6, transcription factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Paired box protein Pax6
    Species: Homo sapiens [TaxId:9606]
    Gene: PAX6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26367 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.05: d2cuea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cueA (A:)
    gssgssgqrnrtsftqeqiealekeferthypdvfarerlaakidlpeariqvwfsnrra
    kwrreeklrnqrrqsgpssg