PDB entry 2cuc

View 2cuc on RCSB PDB site
Description: Solution structure of the SH3 domain of the mouse hypothetical protein SH3RF2
Class: signaling protein
Keywords: SH3 domain, structural genomics, ring finger 2 containing protein, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain containing ring finger 2
    Species: Mus musculus [TaxId:10090]
    Gene: Sh3rf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C1E3 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.06: d2cuca1, d2cuca2, d2cuca3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cucA (A:)
    gssgssgnmfvalhtysahrpeeldlqkgegirvlgkyqdgwlkglslltgrtgifpsdy
    vipvsgpssg