PDB entry 2cu9

View 2cu9 on RCSB PDB site
Description: Crystal structure of Histone chaperone cia1
Class: chaperone
Keywords: immunoglobulin fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on 2005-05-25, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-06-10, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone chaperone cia1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cu9a1
  • Heterogens: PG0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cu9A (A:)
    msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
    lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
    lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn