PDB entry 2cu7

View 2cu7 on RCSB PDB site
Description: Solution structure of the SANT domain of human KIAA1915 protein
Class: transcription
Keywords: Nuclear protein, SANT domain, DNA binding, Regulation of transcription, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-25, released 2005-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1915 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA1915
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VVJ2 (7-71)
    • cloning artifact (0-6)
  Domains in SCOPe 2.06: d2cu7a1, d2cu7a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cu7A (A:)
  gssgssgysvkwtieekelfeqglakfgrrwtkiskligsrtvlqvksyarqyfknkvkc
  gldketpnqktg