PDB entry 2ctx

View 2ctx on RCSB PDB site
Description: the refined crystal structure of alpha-cobratoxin from naja naja siamensis at 2.4-angstroms resolution
Deposited on 1991-09-24, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2ctx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ctx_ (-)
    ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
    ncnpfptrkrp