PDB entry 2ctr

View 2ctr on RCSB PDB site
Description: Solution structure of J-domain from human DnaJ subfamily B menber 9
Class: chaperone
Keywords: DnaJ, J-domain, Chaperone, helix-turn-helix, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DnaJ homolog subfamily B member 9
    Species: Homo sapiens [TaxId:9606]
    Gene: DNAJB9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBS3 (7-81)
      • cloning artifact (0-6)
      • cloning artifact (82-87)
    Domains in SCOPe 2.08: d2ctra1, d2ctra2, d2ctra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ctrA (A:)
gssgssgsyydilgvpksaserqikkafhklamkyhpdknkspdaeakfreiaeayetls
danrrkeydtlghsaftsgkgqsgpssg