PDB entry 2ctn

View 2ctn on RCSB PDB site
Description: structure of calcium-saturated cardiac troponin c, nmr, 30 structures
Class: calcium-binding protein
Keywords: cardiac, muscle, regulatory, calcium-binding protein
Deposited on 1997-05-06, released 1998-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Gene: CTNC(A-CYS)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09860 (2-88)
      • engineered (34)
      • engineered (83)
    Domains in SCOPe 2.07: d2ctna_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ctnA (A:)
    aadiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ctnA (A:)
    adiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
    devdedgsgtvdfdeflvmmvrsmkdds