PDB entry 2cth

View 2cth on RCSB PDB site
Description: cytochrome c3 from desulfovibrio vulgaris hildenborough
Class: electron transport
Keywords: electron transport
Deposited on 1997-06-18, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.161
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ctha_
  • Chain 'B':
    Compound: cytochrome c3
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cthb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cthA (A:)
    apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cthB (B:)
    apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
    sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche