PDB entry 2ctf

View 2ctf on RCSB PDB site
Description: Solution structure of the 4th KH type I domain from human Vigilin
Class: transport protein
Keywords: K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-beta-alpha structure, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vigilin
    Species: HOMO SAPIENS
    Gene: HDLBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00341 (7-95)
      • cloning artifact (0-6)
      • engineered (79)
      • cloning artifact (96-101)
    Domains in SCOP 1.73: d2ctfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ctfA (A:)
    gssgssgepeklgqaltevyakansftvssvaapswlhrfiigkkgqnlakitqqmpkvh
    ieftegedkitlegptedvsvaqeqiegmvkdlinrsgpssg