PDB entry 2cte

View 2cte on RCSB PDB site
Description: Solution structure of the 1st KH type I domain from human Vigilin
Class: transport protein
Keywords: K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-beta-alpha structure, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2005-05-24, released 2005-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Vigilin
  Species: Homo sapiens [TaxId:9606]
  Gene: HDLBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00341 (7-87)
    • cloning artifact (0-6)
    • cloning artifact (88-93)
  Domains in SCOPe 2.08: d2ctea1, d2ctea2, d2ctea3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cteA (A:)
  gssgssgdivarlqtqasatvaipkehhrfvigkngeklqdlelktatkiqiprpddpsn
  qikitgtkegiekarhevllisaeqdkrsgpssg