PDB entry 2ct8

View 2ct8 on RCSB PDB site
Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met) and methionyl-adenylate anologue
Class: Ligase/RNA
Keywords: Ligase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Ligase/RNA COMPLEX
Deposited on 2005-05-23, released 2005-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-12, with a file datestamp of 2010-01-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ct8a1, d2ct8a2
  • Chain 'B':
    Compound: Methionyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ct8b1, d2ct8b2
  • Chain 'C':
    Compound: RNA (74-mer)
  • Chain 'D':
    Compound: RNA (74-mer)
  • Heterogens: MSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ct8A (A:)
    mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
    kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
    lgeyegwycvgceefkseaelaedhtcpihqkkceyikepsyffrlskyqdkllelyekn
    pefiqpdyrrneiisfvkqglkdlsvtrprsrvkwgipvpfdpehtiyvwfdalfnyisa
    ledkveiywpadlhlvgkdilrfhtvywpaflmslgyelpkkvfahgwwtvegkkmsktl
    gnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnringelaneignlysrvvn
    mahkflggevsgardeeyakiaqesiknyenymekvnfykaieeilkftsylnkyvdekq
    pwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqmlgekeflkelkpysk
    ntyklgerkilfpkreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ct8A (A:)
    mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
    kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
    lgeyekepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvtrprsr
    vkwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpafl
    mslgyelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdg
    dfskkailnringelaneignlysrvvnmahkflggevsgardeeyakiaqesiknyeny
    mekvnfykaieeilkftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthlly
    pitpnkmkealqmlgekeflkelkpyskntyklgerkilfpkreg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ct8B (B:)
    mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
    kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
    lgeyegwycvgceefkseaelaedhtcpihqkkceyikepsyffrlskyqdkllelyekn
    pefiqpdyrrneiisfvkqglkdlsvtrprsrvkwgipvpfdpehtiyvwfdalfnyisa
    ledkveiywpadlhlvgkdilrfhtvywpaflmslgyelpkkvfahgwwtvegkkmsktl
    gnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnringelaneignlysrvvn
    mahkflggevsgardeeyakiaqesiknyenymekvnfykaieeilkftsylnkyvdekq
    pwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqmlgekeflkelkpysk
    ntyklgerkilfpkreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ct8B (B:)
    mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
    kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
    lgeyekepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvtrprsr
    vkwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpafl
    mslgyelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdg
    dfskkailnringelaneignlysrvvnmahkflggevsgardeeyakiaqesiknyeny
    mekvnfykaieeilkftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthlly
    pitpnkmkealqmlgekeflkelkpyskntyklgerkilfpkreg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.