PDB entry 2ct7

View 2ct7 on RCSB PDB site
Description: Solution Structure of the IBR domain of the RING finger protein 31 protein
Class: metal binding protein
Keywords: RING finger protein 31, IBR, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RING finger protein 31
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF31
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EP0 (7-79)
      • cloning artifact (0-6)
      • cloning artifact (80-85)
    Domains in SCOPe 2.08: d2ct7a1, d2ct7a2, d2ct7a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ct7A (A:)
    gssgssgalfhkkltegvlmrdpkflwcaqcsfgfiyereqleatcpqchqtfcvrckrq
    weeqhrgrscedfqnwkrmnsgpssg