PDB entry 2ct6

View 2ct6 on RCSB PDB site
Description: solution structure of the sh3 domain-binding glutamic acid-rich-like protein 2
Class: structural genomics, unknown function
Keywords: SH3BGRL2,FASH3, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sh3 domain-binding glutamic acid-rich-like protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: SH3BGRL2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UJC5 (7-104)
    • cloning artifact (0-6)
    • cloning artifact (105-110)
  Domains in SCOPe 2.07: d2ct6a1, d2ct6a2, d2ct6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ct6A (A:)
  gssgssgmvirvfiasssgfvaikkkqqdvvrfleankiefeevditmseeqrqwmyknv
  ppekkptqgnplppqifngdrycgdydsffeskesntvfsflglksgpssg