PDB entry 2ct5

View 2ct5 on RCSB PDB site
Description: Solution Structure of the zinc finger BED domain of the zinc finger BED domain containing protein 1
Class: transcription
Keywords: Zinc finger BED domain containing protein 1, dREF homolog,Putative c-like transposable element, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, transcription
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger BED domain containing protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: ZBED1X
  Database cross-references and differences (RAF-indexed):
  • Uniprot O96006 (7-66)
    • cloning artifact (0-6)
    • cloning artifact (67-72)
  Domains in SCOPe 2.08: d2ct5a1, d2ct5a2, d2ct5a3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ct5A (A:)
  gssgssgskvwkyfgfdtnaegcilqwkkiycricmaqiaysgntsnlsyhleknhpeef
  cefvksnsgpssg