PDB entry 2ct4

View 2ct4 on RCSB PDB site
Description: Solution Strutcure of the SH3 domain of the Cdc42-interacting protein 4
Class: Signaling Protein
Keywords: Cdc42-interacting protein 4, Thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Signaling Protein
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cdc42-interacting protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIP10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15642 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.06: d2ct4a1, d2ct4a2, d2ct4a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ct4A (A:)
    gssgssgghcvaiyhfegssegtismaegedlslmeedkgdgwtrvrrkeggegyvptsy
    lrvtsgpssg