PDB entry 2ct3

View 2ct3 on RCSB PDB site
Description: Solution Structure of the SH3 domain of the Vinexin protein
Class: signaling protein
Keywords: Vinexin,SCAM-1, SH3 domian, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vinexin
    Species: Homo sapiens [TaxId:9606]
    Gene: SCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60504 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.05: d2ct3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ct3A (A:)
gssgssgtpyramyqyrpqnedelelregdrvdvmqqcddgwfvgvsrrtqkfgtfpgny
vapvsgpssg