PDB entry 2ct1

View 2ct1 on RCSB PDB site
Description: Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
Class: Transcription
Keywords: Transcriptional repressor CTCF, CCCTC-binding factor, zinc finger, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcriptional repressor CTCF
  Species: Homo sapiens [TaxId:9606]
  Gene: Ctcf
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49711 (7-70)
    • cloning artifact (0-6)
    • cloning artifact (71-76)
  Domains in SCOPe 2.01: d2ct1a1, d2ct1a2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ct1A (A:)
  gssgssgrthsgekpyecyicharftqsgtmkmhilqkhtenvakfhcphcdtviarksd
  lgvhlrkqhsysgpssg