PDB entry 2csw

View 2csw on RCSB PDB site
Description: Solution structure of the FHA domain of human ubiquitin ligase protein RNF8
Class: ligase
Keywords: 11-stranded beta sandwich, RING finger protein 8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin ligase protein RNF8
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76064 (7-138)
      • cloning artifact (0-6)
      • cloning artifact (139-144)
    Domains in SCOPe 2.07: d2cswa1, d2cswa2, d2cswa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cswA (A:)
    gssgssgvtgdraggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmis
    rnhcvlkqnpegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaey
    eyevteedwetiypclspksgpssg