PDB entry 2csw

View 2csw on RCSB PDB site
Description: Solution structure of the FHA domain of human ubiquitin ligase protein RNF8
Class: ligase
Keywords: 11-stranded beta sandwich, RING finger protein 8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin ligase protein RNF8
  Species: Homo sapiens [TaxId:9606]
  Gene: RNF8
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76064 (7-138)
    • cloning artifact (0-6)
    • cloning artifact (139-144)
  Domains in SCOPe 2.05: d2cswa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cswA (A:)
  gssgssgvtgdraggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmis
  rnhcvlkqnpegqwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaey
  eyevteedwetiypclspksgpssg