PDB entry 2css

View 2css on RCSB PDB site
Description: Solution structure of the PDZ domain of human KIAA0340 protein
Class: endocytosis/exocytosis
Keywords: PDZ domain, Regulating synaptic membrane exocytosis protein 1, Rab3-interacting molecule 1, RIM 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-23, released 2005-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulating synaptic membrane exocytosis protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg01396
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UR5 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.07: d2cssa1, d2cssa2, d2cssa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cssA (A:)
    gssgssgvtwqpskegdrligrvilnkrttmpkdsgallglkvvggkmtdlgrlgafitk
    vkkgsladvvghlragdevlewngkplpgatneevyniilesksepqveiivsrpsgpss
    g