PDB entry 2csq

View 2csq on RCSB PDB site
Description: Solution structure of the second SH3 domain of human RIM-binding protein 2
Class: endocytosis/exocytosis
Keywords: SH3 domain, RIM binding protein 2, RIM-BP2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-05-22, released 2005-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIM binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg00364
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15034 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.06: d2csqa1, d2csqa2, d2csqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2csqA (A:)
    gssgssgtdpgaeelparifvalfdydpltmspnpdaaeeelpfkegqiikvygdkdadg
    fyrgetcarlglipcnmvseiqaddeemmdqsgpssg