PDB entry 2csp

View 2csp on RCSB PDB site
Description: Solution structure of the FNIII domain of human RIM-binding protein 2
Class: endocytosis/exocytosis
Keywords: fn3 domain, RIM binding protein 2, RIM-BP2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-22, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIM binding protein 2
    Species: HOMO SAPIENS
    Gene: KAZUSA cDNA hg00364
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15034 (7-123)
      • cloning artifact (0-6)
      • cloning artifact (124-129)
    Domains in SCOP 1.73: d2cspa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cspA (A:)
    gssgssgvefstlpagppappqdvtvqagvtpatirvswrppvltptglsnganvtgygv
    yakgqrvaevifptadstavelvrlrsleakgvtvrtlsaqgesvdsavaavppellvpp
    tphpsgpssg