PDB entry 2cso

View 2cso on RCSB PDB site
Description: Solution structure of the DEP domain of human pleckstrin
Class: signaling protein
Keywords: DEP domain, Pleckstrin, Platelet p47 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-22, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pleckstrin
  Species: HOMO SAPIENS
  Gene: PLEK, P47
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08567 (7-120)
    • cloning artifact (0-6)
    • cloning artifact (121-126)
  Domains in SCOP 1.73: d2csoa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2csoA (A:)
  gssgssgrsirlpetidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsn
  qsvrnrqeglmiassllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsgffcee
  nsgpssg