PDB entry 2cso

View 2cso on RCSB PDB site
Description: Solution structure of the DEP domain of human pleckstrin
Class: signaling protein
Keywords: DEP domain, Pleckstrin, Platelet p47 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-05-22, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEK, P47
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08567 (7-120)
      • cloning artifact (0-6)
      • cloning artifact (121-126)
    Domains in SCOPe 2.08: d2csoa1, d2csoa2, d2csoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2csoA (A:)
    gssgssgrsirlpetidlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsn
    qsvrnrqeglmiassllnegylqpagdmsksavdgtaenpfldnpdafyyfpdsgffcee
    nsgpssg